Home                                                                                                                                                           
Advertisement

siainformatica.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip62.149.128.157
Statusok
CountryCodeIT
CountryNameItaly
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude42.8333
Longitude12.8333
Alexa traffic rank for siainformatica.com:
Time RangeTraffic RankChange 
3 Months5,757,127-% 
Percent of global Internet users who visit siainformatica.com:
Time RangeReachChange 
3 Months0.000018-% 
Percent of global pageviews on siainformatica.com:
Time RangePageviewsChange 
3 Months0.0000003-% 
Daily pageviews per user for siainformatica.com:
Time RangePageviews/UserChange 
3 Months1.7-% 
The percentage of visits to siainformatica.com that consist of a single pageview:
Time RangeBounce %Change 
3 Months% 
Daily time on site for siainformatica.com:
Time RangeTime on Site(minutes)Change 
The percentage of visits to siainformatica.com that came from a search engine:
Time RangeSearch %Change 
3 Months% 
Advertisement
siainformatica.com
siainformatica.com 7.80 out of 10 based on 12 ratings.
Info siainformatica.com
Alexa Rank: 5,757,127
Title: sia informatica di vigonza, padova - business software
Description: sia informatica: azienda di sviluppo software gestionale e di archiviazione documentale. realizzazione web application personalizzate su piattaforme .net e java.
Visits per day: 198
Daily Ads Revenue: $1.58
Creation Date: 1999-01-28
Domain Age: 18years 212days
Ip: 62.149.128.157
Last update:
05-04-2017 10:29:07 (4 months ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare siainformatica.com to:

www.siainformatica.com

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    skimania.it ≈502$2.722,402,96646.254.34.129
n/a couponlive.it ≈1,147$4.81999,02546.254.34.179
n/a sabinaguzzanti.it ≈502$2.722,173,83846.254.34.179
n/a tomstardust.com ≈904$4.031,248,49146.254.34.204
n/a viavai.com ≈263$1.864,081,84046.254.34.204
n/a gigitrattoria.it ≈74$0.9715,009,52446.254.34.204

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
5,757,119canalauto.com195.5.244.118n/a
5,757,122clubdelpolo.com.ar50.63.69.1n/a
5,757,124web-architectes.com213.165.72.150n/a
5,757,125statusicq.ru188.120.43.141n/a
5,757,126lawfirmmarketingphiladelphia.com184.168.112.134n/a
5,757,127siainformatica.com46.254.34.232n/a -
5,757,129findland.ru188.120.39.223n/a
5,757,131ysk.me202.215.145.157n/a
5,757,138izu3.net202.172.28.24n/a
5,757,139docklandsrealestates.com213.171.218.113n/a
5,757,140outbackatisa.com.au175.107.155.170n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:siainformatica.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags: blacklist nazioni software gestionale informatica archiviazione documentale vigonza software gestionale gestionale acquisire testo da scanner con office scanner in terminal server tool di archiviazione software
Domain Archive: Click here to view details

IP & Spy Tools
Country:
Nameservers: DNS.TECHNORAIL.COM : 62.149.128.2
DNS2.TECHNORAIL.COM : 62.149.132.2
Adsense ID: not found
Analytics ID: UA-9008639
Same Adsense Account: not found
Same Analytics Account: siainformatica.com
Similar Sites: globo.hotelwebnet.net filemakerteam.it badooffice.com amvdesign.it internazionaleauto.com g-mazzaroservice.com ecode-id.com danea.it bozzalegnami.it bortoletto.it sdainformatica.com siamzone.com siamphone.com siamhrm.com siamcafe.net siainteractive.com siaip.it siaic.org siairl.org siai-marchetti.nl
  *adsense and analytics checked for domain root only, and no subpages.
Time Elapsed: 0.48095 sec