Home                                                                                                                                                           
Advertisement

siainformatica.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip62.149.128.157
Statusok
CountryCodeIT
CountryNameItaly
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude42.8333
Longitude12.8333
Alexa traffic rank for siainformatica.com:
Time RangeTraffic RankChange 
3 Months5,757,127-% 
Percent of global Internet users who visit siainformatica.com:
Time RangeReachChange 
3 Months0.000018-% 
Percent of global pageviews on siainformatica.com:
Time RangePageviewsChange 
3 Months0.0000003-% 
Daily pageviews per user for siainformatica.com:
Time RangePageviews/UserChange 
3 Months1.7-% 
The percentage of visits to siainformatica.com that consist of a single pageview:
Time RangeBounce %Change 
3 Months% 
Daily time on site for siainformatica.com:
Time RangeTime on Site(minutes)Change 
The percentage of visits to siainformatica.com that came from a search engine:
Time RangeSearch %Change 
3 Months% 
Advertisement
Owner Name: -
Owner Email: -
Adress: -
Owner Phone: -
siainformatica.com
siainformatica.com 7.80 out of 10 based on 12 ratings.
Info siainformatica.com
Alexa Rank: 5,757,127
Title: sia informatica di vigonza, padova - business software
Description: sia informatica: azienda di sviluppo software gestionale e di archiviazione documentale. realizzazione web application personalizzate su piattaforme .net e java.
Visits per day: 198
Daily Ads Revenue: $1.58
Creation Date: 1999-01-28
Domain Age: 15years 281days
Ip: 62.149.128.157
Last update:
20-10-2014 19:21:16 (1 week ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare siainformatica.com to:

www.siainformatica.com

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    technorail.com ≈1,147$4.81952,11662.149.128.130
    centumcellae.it ≈904$4.031,211,41062.149.128.132
    fipe.it ≈644$3.21,509,72662.149.128.151
    arubapec.it ≈2,315$8.36472,74662.149.128.151
    antikitera.net ≈1,779$6.76632,37962.149.128.151
    cyclinside.com ≈2,603$9.27438,56962.149.128.151
    pontifex.roma.it ≈1,640$6.28661,71362.149.128.151
    kayakluccamdm.it ≈1,445$5.78750,79762.149.128.151
    playerinside.it ≈4,887$16.18239,87462.149.128.151
    linuxguide.it ≈2,170$7.91511,80462.149.128.151
    categoriacigarette.com ≈644$3.21,687,71662.149.128.151
    a-newyork.com ≈904$4.031,060,07862.149.128.151
    sagreinitalia.it ≈4,887$16.18224,62362.149.128.151
    iusreporter.it ≈1,147$4.81962,12362.149.128.151
n/a montecarloguesthouse.it ≈168$1.466,900,73862.149.128.132
n/a mountainone.it ≈0$0062.149.128.132
n/a liceobisceglie.it ≈52$0.7417,827,36062.149.128.132
n/a sintesinet.it ≈134$1.38,055,09862.149.128.132
n/a ciabot.com ≈52$0.7417,115,74262.149.128.132
n/a loredanacannata.com ≈214$1.675,163,23262.149.128.132

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
5,757,119canalauto.com195.5.244.118n/a
5,757,122clubdelpolo.com.ar50.63.69.1n/a
5,757,124web-architectes.com213.165.72.150n/a
5,757,125statusicq.ru188.120.43.141n/a
5,757,126lawfirmmarketingphiladelphia.com184.168.112.134n/a
5,757,127siainformatica.com62.149.128.151n/a -
5,757,129findland.ru188.120.39.223n/a
5,757,130sanbenitofl.org68.178.232.99n/a
5,757,131ysk.me202.215.145.157n/a
5,757,138izu3.net202.172.28.24n/a
5,757,139docklandsrealestates.com213.171.218.113n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:siainformatica.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags: blacklist nazioni software gestionale informatica archiviazione documentale vigonza software gestionale gestionale acquisire testo da scanner con office scanner in terminal server tool di archiviazione software
Domain Archive: Click here to view details

IP & Spy Tools
Country:
Nameservers: DNS.TECHNORAIL.COM : 62.149.128.2
DNS2.TECHNORAIL.COM : 62.149.132.2
Adsense ID: not found
Analytics ID: UA-9008639
Same Adsense Account: not found
Same Analytics Account: siainformatica.com
Similar Sites: globo.hotelwebnet.net filemakerteam.it badooffice.com amvdesign.it internazionaleauto.com g-mazzaroservice.com ecode-id.com danea.it bozzalegnami.it bortoletto.it sdainformatica.com siamzone.com siamphone.com siamhrm.com siamcafe.net siainteractive.com siaip.it siaic.org siairl.org siai-marchetti.nl
  *adsense and analytics checked for domain root only, and no subpages.

Whois Report
Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

   Domain Name: SIAINFORMATICA.COM
   Registrar: TUCOWS.COM CO.
 

Time Elapsed: 0.14501 sec