Home                                                                                                                                                           
Advertisement

radionowindy.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search

Radionowindy.com is ranked #1,641,054 in the world according to the three-month Alexa traffic rankings. The site can be found in the “Radio” category of websites. The site has a bounce rate of about 60% (i.e., 60% of visits consist of only one pageview). The time spent in a typical visit to this site is approximately 75 seconds, with 36 seconds spent on each pageview. Search engines refer roughly 31% of visits to Radionowindy.com.

Ip70.42.66.112
Statusok
CountryCodeUS
CountryNameUnited States
RegionCode36
RegionNameNew York
CityNew York
ZipPostalCode10013
Latitude40.7214
Longitude-74.0052
Alexa traffic rank for radionowindy.com:
Time RangeTraffic RankChange 
1 month1,703,138439,629%
3 Months1,641,054641,971%
Percent of global Internet users who visit radionowindy.com:
Time RangeReachChange 
1 month0.00010-20%
3 Months0.00010-40%
Percent of global pageviews on radionowindy.com:
Time RangePageviewsChange 
1 month% 
3 Months% 
Daily pageviews per user for radionowindy.com:
Time RangePageviews/UserChange 
1 month1.50000-30%
3 Months1.70000-20%
The percentage of visits to radionowindy.com that consist of a single pageview:
Time RangeBounce %Change 
1 month61.50000-2%
3 Months60.000001%
Daily time on site for radionowindy.com:
Time RangeTime on Site(minutes)Change 
1 month1.4033333%
3 Months1.24833-17%
The percentage of visits to radionowindy.com that came from a search engine:
Time RangeSearch %Change 
1 month15.40000-69%
3 Months31.40000-31%
Advertisement
Owner Name: -
Owner Email: -
Adress: -
Owner Phone: -
radionowindy.com
radionowindy.com 7.04 out of 10 based on 83 ratings.
Info radionowindy.com
Alexa Rank: 1,641,054
Title: radionowindy - radionow 100.9
Description: radionowindy.com visitors, seo, traffic and competition. Website located in United States. Hosted in New York. Has the following nameservers: ns1.communityconnect.com, ns2.communityconnect.com. With ip 70.42.66.112. World rank is 1641054.
Visits per day: 644
Daily Ads Revenue: $3.2
Creation Date: 2007-10-10
Domain Age: 6years 291days
Ip: 70.42.66.112
Last update:
09-12-2011 10:54:38 (2 years ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare radionowindy.com to:

www.radionowindy.com

Worldwide Traffic Rank
 

Country Users Rank
    
United States:
86.1% -

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
n/a andyhagans.com ≈405$2.42,583,03866.155.11.238
n/a tocupacional.wordpress.com ≈134$1.38,187,11866.155.11.238
n/a wrkdonau.wordpress.com ≈81$0.9413,578,24466.155.11.238
n/a duttybwoy.wordpress.com ≈236$1.734,562,57166.155.11.238
n/a jlue.wordpress.com ≈108$1.1410,307,99466.155.11.238
n/a jfmaho.wordpress.com ≈214$1.675,169,69966.155.11.238
n/a slcfoodradar.com ≈215$1.626,035,52266.155.11.238
n/a willmcandrew.com ≈52$0.7422,040,92366.155.11.238
n/a cirrusbg.com ≈52$0.7417,749,40966.155.11.238
n/a oopscenities.net ≈88$0.9712,626,78766.155.11.238
n/a freshoutdabox.com ≈114$1.219,896,84166.155.11.238
n/a sandywritesromance.com ≈52$0.7422,435,10566.155.11.238
n/a justanothertrendypage.com ≈198$1.585,825,22166.155.11.238
n/a performancekitchen.org ≈71$0.9715,509,90766.155.11.238
n/a churchofahriman.net ≈214$1.675,323,45866.155.11.238
n/a yzapr.com ≈155$1.397,345,53566.155.11.238
n/a austinlocationscout.com ≈52$0.7422,223,16266.155.11.238
n/a poplifer.com ≈52$0.7417,989,29066.155.11.238
n/a judethefoodie.com ≈502$2.722,404,47566.155.11.238
n/a thefashiongurublog.net ≈405$2.42,692,96466.155.11.238

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
1,641,037clintec.com79.170.44.137n/a
1,641,039webmaster.spb.ru77.221.130.25n/a
1,641,040mcfarlaneasphaltdrivewaypaving.com216.40.47.17n/a
1,641,044erickson-foundation.org174.132.104.244n/a
1,641,049rapidproductdevelopment.biz68.178.254.207n/a
1,641,054radionowindy.com66.155.11.244     United States
1,641,056thebraveawards.com78.109.161.166n/a
1,641,057site-de-referencement.ca69.90.163.140     Canada
1,641,064nativetreesociety.org69.89.25.157     United States
1,641,065balloonlady.co.uk213.171.220.157     United Kingdom
1,641,066jackpotrewards.com208.86.84.42n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:radionowindy.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz:
  • News and Media/Radio
Tags: 100.9 radio indiana radio now radio 1 100.9 radio now now radio 317 in hex snl akon skit i will catch a garnade for you bloomington lil 500 and lil wayne 100.9 radio now 100.9
Domain Archive: Click here to view details

IP & Spy Tools
Country: US
Nameservers: NS1.COMMUNITYCONNECT.COM : 70.42.66.50
NS2.COMMUNITYCONNECT.COM : 70.42.66.51
Adsense ID: not found
Analytics ID: UA-9485903
Same Adsense Account: not found
Same Analytics Account: zhiphopcleveland.com praisedc.com thebeatofphilly.com wiznation.com myspiritdc.com radionowindy.com 92q.com magicbaltimore.com hiphopnc.com praisecleveland.com thelightnc.com mycolumbusjoy.com newstalkcleveland.com wchbnewsdetroit.com mycolumbuspower.com theboxhouston.com thesoulofdfw.com hot1041stl.com praisecharlotte.com majicatl.com oldschool945.com
Similar Sites: radionomy.com radionova.fi radionotredame.net radionof.nl radionoise.ru radionorba.it radionova.it radionostalgia.fm radionotas.com radionora.de
  *adsense and analytics checked for domain root only, and no subpages.

Whois Report
Welcome to the Network Solutions(R) Registrar WHOIS Server.

The IP address from which you have visited the Network Solutions Registrar WHOIS
database is contained within a list of IP addresses that may have failed
to abide by Network Solutions' WHOIS po

Time Elapsed: 0.10233 sec