Home                                                                                                                                                           
Advertisement

music-critic.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip83.138.187.203
Statusok
CountryCodeGB
CountryNameUnited Kingdom
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude54
Longitude-2
Alexa traffic rank for music-critic.com:
Time RangeTraffic RankChange 
1 month1,247,426-2,636,790%
3 Months1,754,413-738,595%
Percent of global Internet users who visit music-critic.com:
Time RangeReachChange 
1 month0.00013220%
3 Months0.0000850%
Percent of global pageviews on music-critic.com:
Time RangePageviewsChange 
1 month% 
3 Months% 
Daily pageviews per user for music-critic.com:
Time RangePageviews/UserChange 
1 month2.20000120%
3 Months2.5000040%
The percentage of visits to music-critic.com that consist of a single pageview:
Time RangeBounce %Change 
1 month62.50000% 
3 Months60.00000-8%
Daily time on site for music-critic.com:
Time RangeTime on Site(minutes)Change 
1 month2.14000% 
3 Months2.09000144%
The percentage of visits to music-critic.com that came from a search engine:
Time RangeSearch %Change 
1 month37.50000% 
3 Months26.70000-39%
Advertisement
music-critic.com
music-critic.com 7.22 out of 10 based on 2 ratings.
Info music-critic.com
Alexa Rank: 3,778,839
Title: 301 Moved Permanently
Description: music-critic.com visitors, seo, traffic and competition. Website located in United Kingdom. Has the following nameservers: ns.rackspace.com, ns2.rackspace.com. With ip 78.136.9.231. World rank is 3778839.
Visits per day: 300
Daily Ads Revenue: $2.02
Creation Date: 1998-06-16
Domain Age: 17years 77days
Ip: 78.136.9.231
Last update:
17-01-2014 05:37:05 (1 year ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare music-critic.com to:

www.music-critic.com

Worldwide Traffic Rank
 

Country Users Rank
    
United Kingdom:
30.2% -

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    ipsosinteractive.com ≈167,481$503.296,59678.136.9.166
    elviscommunications.com ≈904$4.031,138,60278.136.9.218
    thatcherscider.co.uk ≈405$2.42,717,80878.136.9.227
    harvestdigital.com ≈1,214$4.96908,49478.136.9.235
n/a gasco.org.uk ≈52$0.7424,153,27478.136.9.139
n/a yakult.co.uk ≈405$2.42,857,49678.136.9.218
n/a wearethepeoplemovie.com ≈52$0.7418,111,12878.136.9.218
n/a eunavfor.eu ≈1,640$6.28654,09278.136.9.232
n/a lintracker.org ≈94$1.0712,319,95378.136.9.90

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
3,778,829hotelesbogota.net92.43.22.5n/a
3,778,830crocodille.com81.91.85.159n/a
3,778,832easy-web-media.co.uk91.186.20.113n/a
3,778,834onlinemarketingreviewsandtips.com96.125.161.206n/a
3,778,838ukrlitzno.com.ua195.16.88.25     Ukraine
3,778,839music-critic.com78.136.9.231n/a -
3,778,842sigal.fr31.222.193.2n/a
3,778,843adriatravel.me78.46.100.173n/a
3,778,848baysrugby.co.nz60.234.65.226n/a
3,778,849nativemyanmar.net174.132.148.7n/a
3,778,852rochecanada.com196.3.47.30n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:music-critic.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz:
  • Music/Reviews
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Country: GB
Nameservers: NS.RACKSPACE.COM : 69.20.95.4
NS2.RACKSPACE.COM : 65.61.188.4
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites: musicfolio.com musicomh.com musthear.com geocities.com/soho thenightowl.com monstersatplay.com musicmisfits.com musicaltaste.com music-critic.ca musicmonkey.com music-critic.ca
  *adsense and analytics checked for domain root only, and no subpages.
Time Elapsed: 0.0202 sec