Home                                                                                                                                                           
Advertisement

music-critic.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip83.138.187.203
Statusok
CountryCodeGB
CountryNameUnited Kingdom
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude54
Longitude-2
Alexa traffic rank for music-critic.com:
Time RangeTraffic RankChange 
1 month1,247,426-2,636,790%
3 Months1,754,413-738,595%
Percent of global Internet users who visit music-critic.com:
Time RangeReachChange 
1 month0.00013220%
3 Months0.0000850%
Percent of global pageviews on music-critic.com:
Time RangePageviewsChange 
1 month% 
3 Months% 
Daily pageviews per user for music-critic.com:
Time RangePageviews/UserChange 
1 month2.20000120%
3 Months2.5000040%
The percentage of visits to music-critic.com that consist of a single pageview:
Time RangeBounce %Change 
1 month62.50000% 
3 Months60.00000-8%
Daily time on site for music-critic.com:
Time RangeTime on Site(minutes)Change 
1 month2.14000% 
3 Months2.09000144%
The percentage of visits to music-critic.com that came from a search engine:
Time RangeSearch %Change 
1 month37.50000% 
3 Months26.70000-39%
Advertisement
Owner Name: -
Owner Email: -
Adress: -
Owner Phone: -
music-critic.com
music-critic.com 7.22 out of 10 based on 2 ratings.
Info music-critic.com
Alexa Rank: 3,778,839
Title: 301 Moved Permanently
Description: music-critic.com visitors, seo, traffic and competition. Website located in United Kingdom. Has the following nameservers: ns.rackspace.com, ns2.rackspace.com. With ip 78.136.9.231. World rank is 3778839.
Visits per day: 300
Daily Ads Revenue: $2.02
Creation Date: 1998-06-16
Domain Age: 16years 79days
Ip: 78.136.9.231
Last update:
17-01-2014 05:37:05 (7 months ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare music-critic.com to:

www.music-critic.com

Worldwide Traffic Rank
 

Country Users Rank
    
United Kingdom:
30.2% -

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    ipsosinteractive.com ≈167,481$503.296,59678.136.9.166
    elviscommunications.com ≈904$4.031,138,60278.136.9.218
    thatcherscider.co.uk ≈405$2.42,717,80878.136.9.227
    harvestdigital.com ≈1,214$4.96908,49478.136.9.235
n/a gasco.org.uk ≈52$0.7424,153,27478.136.9.139
n/a yakult.co.uk ≈405$2.42,857,49678.136.9.218
n/a wearethepeoplemovie.com ≈52$0.7418,111,12878.136.9.218
n/a eunavfor.eu ≈1,640$6.28654,09278.136.9.232
n/a lintracker.org ≈94$1.0712,319,95378.136.9.90

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
3,778,829hotelesbogota.net92.43.22.5n/a
3,778,830crocodille.com81.91.85.159n/a
3,778,832easy-web-media.co.uk91.186.20.113n/a
3,778,834onlinemarketingreviewsandtips.com96.125.161.206n/a
3,778,838ukrlitzno.com.ua195.16.88.25     Ukraine
3,778,839music-critic.com78.136.9.231n/a -
3,778,842sigal.fr31.222.193.2n/a
3,778,843adriatravel.me78.46.100.173n/a
3,778,848baysrugby.co.nz60.234.65.226n/a
3,778,849nativemyanmar.net174.132.148.7n/a
3,778,852rochecanada.com196.3.47.30n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:music-critic.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz:
  • Music/Reviews
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Country: GB
Nameservers: NS.RACKSPACE.COM : 69.20.95.4
NS2.RACKSPACE.COM : 65.61.188.4
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites: musicfolio.com musicomh.com musthear.com geocities.com/soho thenightowl.com monstersatplay.com musicmisfits.com musicaltaste.com music-critic.ca musicmonkey.com music-critic.ca
  *adsense and analytics checked for domain root only, and no subpages.

Whois Report
The data contained in GoDaddy.com, Inc.'s WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy.  This
information is provided for the sole purpose of assisting you
in

Time Elapsed: 0.01502 sec