Home                                                                                                                                                           
Advertisement

migro.it

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip-
Status-
CountryCode-
CountryName-
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude-
Longitude-
Advertisement
Owner Name: Ingross Levante Srl
Owner Email: -
Adress: Via P. Molfattesi del Risorgimento, 7
Adress: Molfetta
Adress: 70056
Adress: BA
Adress: IT
Owner Phone: -
migro.it
migro.it 7.35 out of 10 based on 15 ratings.
Info migro.it
Alexa Rank: 5,911,120
Title: MIGRO - Ingrosso Alimentari e Vari - Cash and Carry
Description: migro.it visitors, seo, traffic and competition. Has the following nameservers: ns5.widhost.net, ns3.widhost.net. With ip 85.235.131.85. World rank is 5911120.
Visits per day: 198
Daily Ads Revenue: $1.58
Creation Date: No info
Domain Age: N/A
Ip: 85.235.131.85
Last update:
15-04-2012 12:27:17 (2 years ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare migro.it to:

www.migro.it

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    nozzefurbe.com ≈1,214$4.96944,51346.30.241.10
    notebookitalia.it ≈11,780$36.9196,23246.30.241.20
n/a hotelgiumer.it ≈198$1.585,999,52846.30.241.10
n/a bravosystem.net ≈52$0.7423,034,55146.30.241.10
n/a solariumnews.it ≈0$0046.30.241.10
n/a idrofil.it ≈168$1.466,841,93546.30.241.199
n/a medinaples.it ≈0$0046.30.241.199
n/a nycevenice.com ≈198$1.585,788,52446.30.241.62
n/a hotelarcadiaroma.com ≈198$1.585,913,27146.30.241.62
n/a nyceflorence.com ≈214$1.675,044,21346.30.241.62
n/a nohma.it ≈263$1.864,108,73746.30.241.63

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
5,911,108corporatewebstore.com209.62.20.215n/a
5,911,112neatvision.com64.124.14.10n/a
5,911,115jewelrydelmundo.com208.187.218.217n/a
5,911,116weronikarosati.pl195.149.227.108n/a
5,911,119energiedesdauphins.com195.20.231.9n/a
5,911,120migro.it46.30.241.116n/a -
5,911,121srikrishnaswamykalyanamandapam.com67.218.96.160n/a
5,911,126kuenstlerforum-bonn.de82.165.73.238n/a
5,911,134galanto.com46.19.35.177n/a
5,911,139reklamneodznaky.sk93.184.77.112n/a
5,911,143ciklinn.com216.239.38.21n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:migro.it
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Country:
Nameservers: NS5.WIDHOST.NET : 81.2.199.68
NS3.WIDHOST.NET : 85.235.128.167
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.

Whois Report
*********************************************************************
* Please note that the following result could be a subgroup of      *
* the data contained in the database.                               *
*                                           

Time Elapsed: 0.27199 sec