Home                                                                                                                                                           
 

jogmap.de

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search

There are 227,787 sites with a better three-month global Alexa traffic rank than Jogmap.de. This site can be found in the “Verzeichnisse und Portale” category. About 33% of visits to the site are bounces (one pageview only). Visitors to the site spend about 27 seconds on each pageview and a total of four minutes on the site each day. Approximately 25% of visits to Jogmap.de are referred by search engines.

Ip188.40.113.19
Statusok
CountryCodeDE
CountryNameGermany
RegionCode07
RegionNameNordrhein-Westfalen
CityAlexander
ZipPostalCode-
Latitude51.3
Longitude8.3667
Alexa traffic rank for jogmap.de:
Time RangeTraffic RankChange 
1 month212,334-19,535%
3 Months227,788-19,983%
Percent of global Internet users who visit jogmap.de:
Time RangeReachChange 
1 month0.00051%-0.91%
3 Months0.00052%-0.07%
Percent of global pageviews on jogmap.de:
Time RangePageviewsChange 
1 month0.0000292%13%
3 Months0.0000257%8%
Daily pageviews per user for jogmap.de:
Time RangePageviews/UserChange 
1 month5.313%
3 Months4.88%
The percentage of visits to jogmap.de that consist of a single pageview:
Time RangeBounce %Change 
1 month36.1%8%
3 Months33.1%7%
Daily time on site for jogmap.de:
Time RangeTime on Site(minutes)Change 
The percentage of visits to jogmap.de that came from a search engine:
Time RangeSearch %Change 
1 month22.3%-14%
3 Months24.5%-2%
 
jogmap.de
jogmap.de 8.95 out of 10 based on 14 ratings.
Info jogmap.de
Alexa Rank: 413,769
Title: jogmap | Laufstrecken, Marathon, Joggen, Abnehmen durch Laufen
Description: Marathon laufen, Laufstrecken ausmessen, Laufpartner finden bei jogmap. Abnehmen durch Laufen, Marathon Training, Diskutieren: Laufschuhe, Laufuhren und Trainingstipps, Läufer und Laufstrecken in Berlin, Hamburg, Stuttgart, Frankfurt, Köln und M...
Visits per day: 2,603
Daily Ads Revenue: $9.27
Website Worth: $ 4,172
Creation Date: No info
Domain Age: N/A
Domain Expires:
Server Location: Nordrhein-Westfalen, Germany
Domain Registrar: DENIC eG
Ip: 188.40.113.19
Last update:
07-06-2017 05:50:28 (2 months ago)
 

WEBSITES LIKE jogmap.de

Sites Like jogmap.de ( 39 ):

berlin ohio, amish country

berlinohio.com

berlin ohio, the heart of ohios amish country.
sun travel biuro podr\0y, pia, pikna polska, turystyka aktywna, grupy, wycieczki krajowe, wycieczki zagraniczne, kajaki, spywy kajakowe, wypoyczalnia kajakw, incentive

pieknapolska.com

wycieczki szkolne, wakacje, kajak, wypoczynek, pikna polska,praga, krpsko, spyw draw, tropikalna wyspa, wypoyczalnia kajakw, wiede, spywy kajakowe, polietylenowej, incentive, kajak bri
the berlin fan page

berlinpage.com

berlin web site. history, images, tour dates, sound clips, and everything related to berlin / terri nunn / etc. with information on new ep, music bands reunited vh1 vh-1 john crawford david diamond
berlin cameron united

bc-p.com

berlin cameron united is a leading creative advertising agency in the us, offering ad development services for television, print, and interactive media, as well as services for campaign planning and m
:::::::::::blanca berlin galeria fotografica::::::::::::::

blancaberlingaleria.com

blanca berln0020galera0020ya se ha convertido en un punto de encuentro del arte fotogrf0069co madrileo00200079 en un referente en el panorama arts0074ico nacional e internacional. especializada en fotografa0020y art
berlin // voy a berlin - guia de berlin

voyaberlin.com

gua0020de berln0020con informacin00200073obre la ciudad de berlin. monumentos de berlin, historia, turismo, albergues, transporte pb006c00690063o en berlin y consejos prc0074icos para visitar berlin.
immobilie-suchen.com - aktuelle immobilienangebote in europa

immobiliesuchen.com

die neuesten eintr䧥 der immobilienb\0 bei www.immobilie-suchen.com - immobiliendatenbank f\0tschland und europa mit immobilien in deutschland \0rreich schweiz italien griechenland spanien sc
apartamentos berl㭮 - alojamiento en el mar menor

apberlin.com

apartamentos berlin. estudios en una zona tranquila de lo pag㡮 (san pedro del pinatar - murcia). trato directo y atenci㳮 al cliente. disfrute de sus vacaciones al mejor precio.
berlin - j껹k angielski, niemiecki... kursy! szkoa j껹k\0bcych

berlin.edu.pl

,berlin - j껹k niemiecki angielski i inne - szkoa j껹k\0bcych sjo
h.g. hagelgans heizungs-, feuerungsbau und sanit䳴echnik gmbh

hagelgans-gmbh.de

heizung-,feuerungsbau-,& sanit䳴echnik gmbh
astrologie, horoskope, berlin - birgit von borstel

birgitvonborstel.de

psychologische astrologie, horoskope, berlin - birgit von borstel
gesang inez otto

inez-otto.de

homepage von inez otto.
sv s㽤en 09 e.v.: startseite

sueden-09.de

dies ist die offizielle homepage des sv s㽤en 09 e.v. - der fu㿢allverein in berlin-mariendorf
home – mews steuerberatung – berlin ⻠mews steuerberatung - berlin

mews-steuerberatung.de

steuerkummer? – servicenummer tel.: 030-851 20 37
Helliwood media & education

helliwood.de

"Nil tam difficile est, quod non sollertia vincat!"
weihnachtsmarkt auf dem winterfeldtplatz in berlin

weihnachtsmarkt-winterfeldtplatz.de

der traditionelle weihnachtsmarkt auf dem winterfeldtplatz ist einzigartig und an den adventssonntagen geet.
Zahar.de -

zahar.de

desc
schweiger design | herzlich willkommen

schweiger-design.de

wir sind eine grafik und design agentur in der brandenburgischen landeshauptstadt potsdam nahe berlin
art-repro der fotograf christoph petras aus berlin

art-repro.de

willkommen bei art-repro.de, der fotografischen dienst fstler
berlin tours – walking tour, bike tour, bus tour, berlin wall tour - sightseeing in berlin

sightseeing-point-berlin.com

sightseeing in berlin: tour guides, berlin tours, walking tours, bike tours, bus tours, berlin wall tour and more
Rechtsanwlte Fachanwlte Steuerberater - RKKM - Berlin Prenzlauer Berg und Dresden

rkkm.de

Spezialisierung und Fortbildung sichern den Standard unserer Dienstleistung fr den Mandanten. In unseren Kanzleien in Berlin und Dresden sind Fachanwlte in den Rechtsgebieten Steuerrecht, Arbeitsrecht, Miet- und Wohnungseigentumsrecht, Strafrecht und Fa
atemtherapie und gestalttherapie - karin sorgenfrei & k䵨e schmid

atem-und-gestalt.de

praxis fm-und gestalttherapie berlin bietet psychologische begleitung in krisen und bei allen existentiellen themen, einzel-und paartherapie an
voyage- die band fߥ und kleine feste aus berlin spielt jazz, bossa und soul

voyagemusic.de

die jazzband voyage spielt als jazzduo, jazztrio oder im quintett auf ihrer hochzeit, betriebsfeier oder event jazz, bossa und pop
pension a. bergermann, berlin - zimmervermietung und unterkunft im grünen berlin

ab-pension.de

pension bergermann, berlin - zimmervermietung und unterkunft für urlaub, geschäftsreise und kurzaufenthalt in der hauptstadt.
Clubtime.de | Parties, Konzerte, Events

clubtime.de

Deutschlands Online-Partyguide. Die aktuellen Parties, Events und Konzerte aus dem ganzen Bundesgebiet.
hausverwaltung haߥlbarth - wohnungen mieten und immobilien kaufen in berlin und brandenburg

hasselbarth.de

hausverwaltung haߥlbarth, wohnung mieten und immobilie kaufen - in berlin und brandenburg
arashi jkc berlin e.v., the best of judo in berlin

arashi-berlin.de

judo ist bei arashi, traditionell der schwerpunkt der arbeit. seit 0 jahren unterrichten wir nun schon judo und kn voller stolz auf unsere erfolgreiche geschichte zuricken. arashi jkc
tendoryu aikido berlin

tendoryu-aikido.org

aikido berlin, kawaraban mit artikeln von kenji shimizu sensei, trainingszeiten f㽲 erwachsene und kinder, dojodatenbank, bilder, videos, b㽣her, ...
traditionelle chinesische medizin (tcm) in berlin

praxis-vonwnuk.de

beschreibung des angebots der auml;rztin bettina von wnuk-lipinski f㽲 traditionelle chinesische medizin, akupunktur, qi gong und tunia
FAD art fast news

fadwebsite.com

Art news and private views, London and global. Featuring reports and opinion from art fairs and galleries on contemporary art, photography, street art, video, design, performance art, sculpture and more.

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare jogmap.de to:
 

www.jogmap.de

Worldwide Traffic Rank
Country Rank
    
Germany:
8,636

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
n/a absolunet.net ≈52$0.7419,138,065188.40.113.104
n/a es.storecigarettes.net ≈904$4.031,273,097188.40.113.12
n/a globe-berlin.com ≈144$1.347,763,037188.40.113.122
n/a lofty-tours.com ≈52$0.7419,158,309188.40.113.122
n/a kanada-tipps.de ≈214$1.675,485,701188.40.113.122
n/a c-schnitzler.eu ≈52$0.7425,801,511188.40.113.122
n/a handwerkspreis.at ≈214$1.675,177,446188.40.113.122
n/a kfz-salzburg.at ≈71$0.9715,995,342188.40.113.122
n/a reiters.at ≈52$0.7417,736,195188.40.113.122
n/a neisseland.de ≈81$0.9413,600,416188.40.113.122

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
413,756tradeinterceptor.com188.138.86.17     United States
413,758mansworldindia.com104.199.118.179     India
413,762maxipago.com216.239.34.21     Brazil
413,763nicubunu.ro67.205.45.225n/a
413,768alcinea.com200.98.197.34     Brazil
413,769jogmap.de188.40.113.19n/a -
413,770hogrefe.ch212.203.117.142     Germany
413,771thenbageek.com174.129.212.2     Colombia
413,773girlzinweb.com213.186.33.4     France
413,775ezwprotator.com50.28.8.199     United States
413,776on-web.fr79.99.164.49     France

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:jogmap.de
Yahoo Indexed Links: Go to http://siteexplorer.search.yahoo.com and type jogmap.de
Google backlinks: Go to www.google.com and type link:jogmap.de
Yahoo backlinks: Go to http://siteexplorer.search.yahoo.com and type jogmap.de
Dmoz: No
Tags: Laufstrecken Marathon Training Laufpartner finden Jogging Joggen Laufuhr Berlin Hamburg Stuttgart Frankfurt Laufpartner
Domain Archive: Go to http://whois.domaintools.com and type your site.

IP & Spy Tools
Nameservers: NS-DE.1AND1-DNS.BIZ : 217.160.81.1
NS-DE.1AND1-DNS.COM : 217.160.82.1
NS-DE.1AND1-DNS.DE : 217.160.80.1
NS-DE.1AND1-DNS.ORG : 217.160.83.1
Adsense ID: pub-3075999993942989
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites: spiegel.de amazon.de 100partnerprogramme.de
  *adsense and analytics checked for domain root only, and no subpages.

DNS Records
HostTypeTarget / IPClassTTLOther
www.jogmap.deA188.40.113.19IN1201 
www.jogmap.de has address 188.40.113.19

Headings - Seo Onpage
H1H2H3H4H5H6
579000
H1
Liebe Läufer, Jogger, Walker,
Willkommen bei jogmap
Laufstrecken finden
Kostenlose Trainingstipps
Kostenlose Tools
H2
herzlich willkommen bei jogmap
jogmap-Angebot
jogmap-Angebot
jogmap-Angebote
Schon über 1.000.000 Laufstrecken
Abnehmen
H3
You'll never jog alone!
Über 800.000 Laufstrecken
Trainingspläne, Podcasts, Tipps
Gratis Tools für Läufer
Das ist jogmap:
Umfrage
Kostenlose Trainingspläne
Videos

Onpage data links

Internal Links

TextTitleLink
Mein jogmaphttp://jogmap.de/../civic4/?q=front_page
Communityhttp://jogmap.de/../civic4/?q=node/7799
Wettkampf/Traininghttp://jogmap.de/../civic4/?q=node/7800
Laufstreckenhttp://jogmap.de/../civic4/?q=node/7817
Profilhttp://jogmap.de/../civic4/?q=user
Läufehttp://jogmap.de/../civic4/?q=node/22
Streckenhttp://jogmap.de/../civic4/?q=node/9
Schuhehttp://jogmap.de/../civic4/?q=node/5273
Statistikhttp://jogmap.de/../civic4/?q=node/20395
Buddieshttp://jogmap.de/../civic4/?q=node/28720
Bloghttp://jogmap.de/../civic4/?q=node/7802
Alarmhttp://jogmap.de/../civic4/?q=node/10145
http://www.jogmap.de/civic4/?q=/user/register
Willkommen bei jogmaphttp://www.jogmap.de/civic4/?q=/user/register
Gratis anmeldenhttp://www.jogmap.de/civic4/?q=/user/register
http://www.jogmap.de/civic4/?q=/user/register
Laufstrecken findenhttp://www.jogmap.de/civic4/?q=/user/register
Gratis anmeldenhttp://www.jogmap.de/civic4/?q=/user/register
http://www.jogmap.de/civic4/?q=/user/register
Kostenlose Trainingstippshttp://www.jogmap.de/civic4/?q=/user/register

External Links

TextTitleLink
Firefoxhttp://www.getfirefox.com
Internetexplorerhttp://www.microsoft.com/germany/windows/products/winfamily/ie/default.mspx
Safarihttp://www.apple.com/de/safari/
Frontpage Slideshow (version 1.7.2) - Copyright © 2006-2008 by JoomlaWorkshttp://www.joomlaworks.gr
Computerbild.de,http://www.computerbild.de/artikel/cb-Aktuell-Internet-Jogmap-Online-Treff-fu...
RTL2http://www.rtl2.de/2849.html

Backlinks Scheme

Backlinks Graphic

Safety
Avg AntivirusSafe
Wot RaitingExcellent
SiteAdvisorNot yet rated
Child SafetyExcellent

Search Volume Index
Time Elapsed: 0.91717 sec
aaa