Home                                                                                                                                                           
Advertisement

highaltitudeauction.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip208.89.163.159
Statusok
CountryCodeUS
CountryNameUnited States
RegionCode56
RegionNameWyoming
CityCheyenne
ZipPostalCode82007
Latitude41.0784
Longitude-104.74
Daily time on site for highaltitudeauction.com:
Time RangeTime on Site(minutes)Change 
Advertisement
highaltitudeauction.com
highaltitudeauction.com 8.28 out of 10 based on 21 ratings.
Info highaltitudeauction.com
Alexa Rank: 18,312,566
Title: High Altitude Auction
Description: highaltitudeauction.com visitors, seo, traffic and competition. Website located in United States. Hosted in Cheyenne. Has the following nameservers: ns47.domaincontrol.com, ns48.domaincontrol.com. With ip 104.27.168.188. World rank is 18312566.
Visits per day: 52
Daily Ads Revenue: $0.74
Creation Date: 2008-07-31
Domain Age: 10years 299days
Ip: 104.27.168.188
Last update:
04-03-2018 22:28:54 (1 year ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare highaltitudeauction.com to:

www.highaltitudeauction.com

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
n/a morganlawyers.com ≈126$1.248,895,435104.27.169.106
n/a festivaletteratura.it ≈644$3.21,811,157104.27.169.110
n/a solen.ca ≈644$3.21,699,226104.27.169.137
n/a ma7room.com ≈9,062$28.66111,136104.27.169.163
n/a antio.ru ≈9,062$28.66134,804104.27.169.173
n/a gailmcwilliams.com ≈94$1.0712,233,949104.27.169.176
n/a digitalfotoforalla.se ≈1,779$6.76635,842104.27.169.178
n/a tafreeh.com ≈88$0.9712,649,387104.27.169.189
n/a american-schools.net ≈86$0.9313,377,501104.27.169.196
n/a aelitaxtranslate.com ≈16,592$51.2565,074104.27.169.198
n/a peyvand.com ≈1,214$4.96934,733104.27.169.200
n/a aqaed.org ≈405$2.42,810,328104.27.169.202
n/a estrenosdtl.com ≈89,693$270.4614,257104.27.169.202
n/a savorsilver.com ≈122$1.249,092,872104.27.169.211
n/a jacknoticias.com ≈502$2.722,193,858104.27.169.216
n/a raotin24h.vn ≈52$0.7419,403,930104.27.169.228
n/a pontiacforum.com ≈644$3.21,954,380104.27.169.6
n/a modenacam.com ≈904$4.031,454,498104.27.169.82
n/a solvedns.com ≈1,358$5.46800,040104.27.169.90
n/a radiomelodiehaiti.com ≈134$1.38,253,607104.27.169.92

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
18,312,541simplyheavenmassageandskincare.com89.20.93.12n/a
18,312,542bigbearsgym.net98.139.135.22n/a
18,312,554draincleaninggenie.com69.89.31.210n/a
18,312,562topnet.gr66.84.12.233n/a
18,312,565skinnybulkup.com172.99.89.230n/a
18,312,566highaltitudeauction.com104.27.169.188n/a -
18,312,573kendo.te.ua91.198.10.4n/a
18,312,580clarkesworldbooks.com198.144.194.13n/a
18,312,581castelletto.info62.149.128.166n/a
18,312,587sunshinewatersportspcb.com72.167.232.157n/a
18,312,590asisred.com.ar190.183.61.24n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:highaltitudeauction.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Country:
Nameservers: CARL.NS.CLOUDFLARE.COM : 173.245.59.106
SARA.NS.CLOUDFLARE.COM : 173.245.58.144
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.
Time Elapsed: 0.18819 sec