Home                                                                                                                                                           
Advertisement

highaltitudeauction.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip208.89.163.159
Statusok
CountryCodeUS
CountryNameUnited States
RegionCode56
RegionNameWyoming
CityCheyenne
ZipPostalCode82007
Latitude41.0784
Longitude-104.74
Daily time on site for highaltitudeauction.com:
Time RangeTime on Site(minutes)Change 
Advertisement
highaltitudeauction.com
highaltitudeauction.com 8.28 out of 10 based on 21 ratings.
Info highaltitudeauction.com
Alexa Rank: 18,312,566
Title: High Altitude Auction
Description: highaltitudeauction.com visitors, seo, traffic and competition. Website located in United States. Hosted in Cheyenne. Has the following nameservers: ns47.domaincontrol.com, ns48.domaincontrol.com. With ip 104.27.168.188. World rank is 18312566.
Visits per day: 52
Daily Ads Revenue: $0.74
Creation Date: 2008-07-31
Domain Age: 10years 85days
Ip: 104.27.168.188
Last update:
04-03-2018 22:28:54 (7 months ago)
Advertisement

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare highaltitudeauction.com to:

www.highaltitudeauction.com

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
    freetv247.com ≈1,519$5.96744,917104.27.168.62
n/a 10youtube.com ≈182,921$549.955,560104.27.168.102
n/a dklikk.be ≈904$4.031,219,954104.27.168.105
n/a pyxida.org.gr ≈168$1.466,938,679104.27.168.115
n/a ozo.bg ≈263$1.864,364,190104.27.168.12
n/a tvklan.al ≈182,921$549.955,847104.27.168.129
n/a mirtattoo.ru ≈904$4.031,392,904104.27.168.158
n/a parapolitika.gr ≈89,693$270.4611,171104.27.168.177
n/a helenamt.com ≈344$2.183,015,484104.27.168.182
n/a bettiepage.com ≈904$4.031,223,662104.27.168.192
n/a egs.ca ≈52$0.7424,163,891104.27.168.225
n/a glasgowmuseums.com ≈168$1.466,998,521104.27.168.239
n/a pinupjobs.com ≈2,982$10.4377,040104.27.168.248
n/a ringpass.nl ≈144$1.347,630,250104.27.168.3
n/a marathonclub.net ≈81$0.9413,902,285104.27.168.55
n/a urbanministries.com ≈644$3.21,570,546104.27.168.60
n/a qatarliving.com ≈231,243$694.964,952104.27.168.65
n/a nrlleague.com.au ≈134$1.38,282,204104.27.168.95
n/a turgranada.es ≈1,779$6.76629,198104.27.168.96

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
18,312,541simplyheavenmassageandskincare.com89.20.93.12n/a
18,312,542bigbearsgym.net98.139.135.22n/a
18,312,554draincleaninggenie.com69.89.31.210n/a
18,312,562topnet.gr66.84.12.233n/a
18,312,565skinnybulkup.com172.99.89.230n/a
18,312,566highaltitudeauction.com104.27.168.188n/a -
18,312,573kendo.te.ua91.198.10.4n/a
18,312,580clarkesworldbooks.com198.144.194.13n/a
18,312,581castelletto.info62.149.128.166n/a
18,312,587sunshinewatersportspcb.com72.167.232.157n/a
18,312,590asisred.com.ar190.183.61.24n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:highaltitudeauction.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Country:
Nameservers: CARL.NS.CLOUDFLARE.COM : 173.245.59.106
SARA.NS.CLOUDFLARE.COM : 173.245.58.144
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.
Time Elapsed: 1.48129 sec