Home                                                                                                                                                           
Advertisement

dhammavideo.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip208.167.236.69
Statusok
CountryCodeUS
CountryNameUnited States
RegionCode34
RegionNameNew Jersey
CitySayreville
ZipPostalCode08872
Latitude40.4619
Longitude-74.3561
Alexa traffic rank for dhammavideo.com:
Time RangeTraffic RankChange 
3 Months703,802% 
Percent of global Internet users who visit dhammavideo.com:
Time RangeReachChange 
3 Months0.00014% 
Percent of global pageviews on dhammavideo.com:
Time RangePageviewsChange 
3 Months0.0000058% 
Daily pageviews per user for dhammavideo.com:
Time RangePageviews/UserChange 
3 Months3.8% 
The percentage of visits to dhammavideo.com that consist of a single pageview:
Time RangeBounce %Change 
3 Months13.5% 
Daily time on site for dhammavideo.com:
Time RangeTime on Site(minutes)Change 
The percentage of visits to dhammavideo.com that came from a search engine:
Time RangeSearch %Change 
3 Months5.4% 
Advertisement
dhammavideo.com
dhammavideo.com 10.00 out of 10 based on 15 ratings.
Info dhammavideo.com
Alexa Rank: 5,344,408
Title: Dhamma Video
Description: dhammavideo.com visitors, seo, traffic and competition. Website located in United States. Hosted in Sayreville. Has the following nameservers: ns1149.dns.dyn.com, ns2199.dns.dyn.com, ns3160.dns.dyn.com, ns4189.dns.dyn.com. With ip 45.35.75.100. World rank is 5344408.
Visits per day: 214
Daily Ads Revenue: $1.67
Website Worth: $ 752
Creation Date: 2010-08-09
Domain Age: 7years 109days
Domain Expires: N/A
Server Location: New Jersey, United States
Domain Registrar: CLICK REGISTRAR, INC. D/B/A PUBLICDOMAINREGISTRY.COM
Ip: 45.35.75.100
Last update:
23-10-2017 18:55:09 (1 month ago)
Advertisement

WEBSITES LIKE dhammavideo.com

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare dhammavideo.com to:
 

www.dhammavideo.com

Worldwide Traffic Rank
Country Rank
    
Macao:
848

Websites Hosted On Same Network Analysis
No sites were found to be hosted in the same network with dhammavideo.com

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
5,344,386buyrealestateintheus.com98.136.92.206n/a
5,344,391machineryclassifieds.com69.73.133.56n/a
5,344,395gowansnet.com174.132.195.194n/a
5,344,400optom-toys.ru85.25.166.102n/a
5,344,405brooklynmedicalmalpracticelawyersfirm.com173.201.164.121n/a
5,344,408dhammavideo.com45.35.75.100n/a -
5,344,409neverendingbooks.org143.129.75.25n/a
5,344,410pasaportealareinvencion.com76.74.254.120n/a
5,344,414alliedbrass.com208.112.14.78n/a
5,344,425gladstoneparkchefs.co.uk217.10.145.146n/a
5,344,426sdsusa.com66.173.66.194n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:dhammavideo.com
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags:
Domain Archive: Click here to view details

IP & Spy Tools
Nameservers: NS1.GOWHM.COM : 45.35.75.100
NS2.GOWHM.COM : 45.35.75.119
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.

DNS Records
HostTypeTarget / IPClassTTLOther
dhammavideo.comA208.167.236.69IN20 
dhammavideo.comNS IN43200target: ns3160.dns.dyn.com
dhammavideo.comNS IN43200target: ns1149.dns.dyn.com
dhammavideo.comNS IN43200target: ns4189.dns.dyn.com
dhammavideo.comNS IN43200target: ns2199.dns.dyn.com
www.dhammavideo.comCNAME IN20target: dhammavideo.com
dhammavideo.comSOA IN43200mname: ns1.mydyndns.org
rname: zone-admin.dyndns.com
serial: 2011053061
refresh: 10800
retry: 1800
expire: 604800
minimum-ttl: 1800
dhammavideo.comTXT IN600txt: v=spf1 ip4:208.167.236.69 +a +mx ?all
entries: Array
dhammavideo.com has address 208.167.236.69

Headings - Seo Onpage
H1H2H3H4H5H6
4600000
H1
Peacekeeper Myanmar Monk Venerable Wirathu ဆရာေတာ္ ဦးဝီရသူ
အမ်ိဳးေစာင့္ဥပေဒ ျပဌာန္းေရး ဝိုင္းဝန္းပူးေပါင္း ေဆာင္႐ြက္ေပး
အရွင္ဝီရသူု ( ငရဲမွ အျပန္ ) Wirathu return from hell
အက္(စ္)ဂြန္ေအာင္ (ခ) Rev.T.Peter / S-Gun Aung (Professor) ၏ ကမာၻေက်ာ္သည့္ လိမ္လည္ေစာ္ကားမႈ ေဖာ္ထုတ္ျခင္းမွတ္တမ္း
ဒိ႒ိအမွန္ ရုပ္ႏွင့္နာမ္ - ဓမၼပူဇာေတး
သူငယ္တန္း ျမန္မာဖတ္စာ - ပညာေရး၀န္ၾကီးဌာန
ေအာင္မဂၤလာ ဆရာေတာ္ - ေအာင္ဓမၼရိပ္သာ (မရမ္းကုန္း) Dhamma Radio
သမုိင္း၏တရားခံ --- စာေရးသူ (ဝီရသူ)
မိုးျပာဝါဒဆိုသည္မွာ...
ေဝဒနာရွုပံု
ငရဲအေၾကာင္း သိေကာင္းစရာမ်ား - ခ်မ္းေျမ႕ျမိဳင္ဆရာေတာ္
ေတာင္တန္းသာသနာျပဳ ဆရာေတာ္ဘုရားႀကီး၏ ဂုဏ္ေတာ္ကြန္ခ်ာ ရြတ္ပြားပုံ
အရိေမေတၱယ် ျမတ္စြာဘုရား အေၾကာင္း သိေကာင္းစရာမ်ား - ပဲခူးဆရာေတာ္ ဘဒၵႏၲေတေဇာသာရ
“နိဗၺာန္တံခါးဖြင့္တရားေတာ္” - ဗန္းေမာ္ဆရာေတာ္ Daly City, CA
ပ႒ာန္း ပစၥယုေဒၵသ ႏွင့္ ပစၥယနိေဒၵသ ပါဠိေတာ္
ပရိတ္ႀကီး နိႆယသစ္ (သေျပကန္ ဆရာေတာ္)
ေက်ာက္သေဘၤာဝိနိစၧယ
လူေသလူၿဖစ္ဝိနိစၧယ (အဆုံးအျဖတ္)
ပရိတ္ၾကီး ၁၁-သုတ္ၿမန္မာၿပန္
ေတဘုမၼာ႐ွင္းတမ္း - ေမာင္ေမာင္ႀကီး၊ တင္တင္ျမ၊ ရီရီသန္႔
ဆရာေတာ္ႀကီးမ်ား၏ ၾသ၀ါဒမ်ား တရားေတာ္ - အ႐ွင္ေဆကိႏၵ(ဓမၼဒူတ)
ဥပုသ္ေစာင့္ျခင္း အဓိပၸါယ္ တရားေတာ္ - ပါေမာကၡခ်ဳပ္ ေဒါက္တာနႏၵမာလာဘိဝံသ
ေ႐ႊလင္းယုန္ဆရာေတာ္၏ ပရိတ္ႀကီး(၁၁)သုတ္ တရားေတာ္
မိ႐ိုးဖလားဗုဒၶဘာသာ ႏွင့္ တကယ့္ဗုဒၶဘာသာ တရားေတာ္ - အ႐ွင္ဇဝန(ေမတၱာ႐ွင္ဆရာေတာ္)
တရားစစ္၊ တရားမွန္ေရြးရန္ နည္းလမ္းေလးသြယ္ - မင္းကြန္းဆရာေတာ္ဘုရားႀကီး (ဆဌသံဂါယနာတင္မွ)
ငဘတို႔႐ြာ - ကိုထြန္းေ႐ႊ
The Buddha's Eight Conquests
ေခါင္းဖီးထားမွ ပန္လို႔ရ တရားေတာ္ (အရိေမတၱယ်ဗုဒၶဝင္) - ဦးေတေဇာသာရ (ပဲခူးဆရာေတာ္) - အပိုင္း(၁) - kptm-1
ငါးပါးသီလေပး - ဆရာေတာ္ဦးသာသန
ကံေပးတဲ႔ဘဝ ဉာဏ္ေလးနဲ႔ျဖတ္ တရားေတာ္ - ဦးေသာမ(ဓမၼစႀကၤာ-ထားဝယ္)
ပဋိစၥသမုပၸါဒ္အေျခခံတရားေတာ္ - ဦးေဃာသိတ(ကမၼာဠာနစရိယ)
၈ပါးသီလတရားေတာ္ - ဦးဝိနယ (သာမညေတာင္ ဆရာေတာ္ဘုရားႀကီး)
အလုိက္ေပးမွလဲလို႕ရ - ဘဒၶ ႏၱေတေဇာသာရ (ပဲခူးဆရာေတာ္)
သီလရွင္းတမ္းႏွင့္၀ိပႆနာ ၁+၂ - ဘဒၶ ႏၱနရပတိ (ျဖဴးဆရာေတာ္)
ဆရာေတာ္ဘဒၵႏၱ ကုမာရ၏ ကိုးပါးသီလေပး
မုိးကုတ္ဆရာေတာ္ဘုရားၾကီး၏ ရွစ္ပါးသီလေပး
DHAMMA TV CHANNEL 9 - MYANMAR DISNEY - ကေလးမ်ားအတြက္ ဗဟုသုတရဖြယ္ရာမ်ား
သီလႏွင့္ပညာ တရားေတာ္ - သီတဂူဆရာေတာ္ အ႐ွင္ဉာဏိႆရ
DHAMMA RADIO CHANNEL 3 - သဲအင္းဂူဆရာေတာ္ဘုရားႀကီး ဦးဥကၠ႒ dhammaradio3@gmail.com
ဝိသာခ ႏွင့္ ဓမၼဒိႏၷာ အေမး၊ အေျဖ တရားေတာ္ - ဦးသံဝရ(မံုလယ္ဆရာေတာ္)
ေခါင္းဖီးထားမွ ပန္လို႔ရ တရားေတာ္ (အရိေမတၱယ်ဗုဒၶဝင္) - ဦးေတေဇာသာရ(ပဲခူး) အပိုင္း (၁ မွ ၄)အထိ - kptm-1 to 4
ဆရာ႐ိွပါတယ္ တရားေတာ္ - ဦးေဆကိႏၵ(ဓမၼဒူတ)
ဓမၼကထိကမ်ားအား ဆရာေတာ္ႀကီးမ်ားရဲ႕ၾသ၀ါဒ - မဂၤလာတုိက္ - ဦးသုမဂၤလ(ဒယ္အိုးဆရာေတာ္)
အေမြခံထိုက္သူျဖစ္ပါေစ (1 to 3) - ဦးေကာ၀ိဒ
ပဌာန္းပါဠိေတာ္အက်ယ္ - မင္းကြန္းဆရာေတာ္
နွလံုးသြင္းမွားတာနွင့္မွန္တာ - ဘဒၵႏ ၱ သံ၀ရ

Onpage data links

Internal Links

TextTitleLink
မွတ္ပံုတင္ရ...http://www.dhammavideo.com/signup/
User Loginhttp://www.dhammavideo.com/login
http://www.dhammavideo.com/submit/
HOMEVideohttp://www.dhammavideo.com/
ေစတီပုထိုးမ်ား Pagodaေစတီပုထို...http://www.dhammavideo.com/c/8/1/
စုေပါင္း ရဟန္းခံစုေပါင္း ရဟ...http://www.dhammavideo.com/media/150/1/
ေတာင္တန္းသာသနာျပဦးဥတၱမသာရhttp://dhammavideo.com//c/20/1/
တြံေတးဆရာေတာ္ဘဒၵႏၲဣႏၵကhttp://dhammavideo.com//c/37/1/
ဦးဇင္းကိတၱိသာရဦးဇင္းေက်...http://dhammavideo.com//c/68/1/
ဦးနာဂိႏၵလကၤာရဦးနာဂိႏၵလကၤာရhttp://dhammavideo.com//c/48/1/
ပုညာရာမဆရာေတာ္ဦးပုညာနႏၵhttp://dhammavideo.com//c/50/1/
ဝါခင္းကုန္းဆရာေတဘဒၵႏၲတိကၡhttp://dhammavideo.com//c/43/1/
ေယာဆရာေတာ္ဘဒၵႏၲသိရိႏၵာဘိဝ...http://dhammavideo.com//c/73/1/
ေရစႀကိဳဆရာေတာ္ဘဒၵႏၲဝါယာမိ...http://dhammavideo.com//c/34/1/
ေရႊေတာင္ကုန္းဆရာဦးပ႑ိတhttp://dhammavideo.com//c/165/1/
ဦးသုမနစစ္ကိုင္းေတာင္ရိုး...http://dhammavideo.com//c/162/1/
သဲအင္းဂူဆရာေတာ္ဘဒၵႏၲဥကၠ႒http://dhammavideo.com//c/18/1/
ဦးဝီရသူ (မစိုးရိမဦးဝီရသူ (...http://dhammavideo.com//c/176/1/
သမိုင္း (မွတ္တမ္းမေထရုပတၱိ၊...http://dhammavideo.com//c/82/1/
Bamaw SayardawBamaw Sayardawhttp://dhammavideo.com//c/187/1/

External Links

TextTitleLink
Android Phone VersionMobile Phone (Android)https://play.google.com/store/apps/details?id=com.rabbitradio.android
iPhone iPad iOS Radio ApplicationDhamma Radio for iPhonehttp://itunes.apple.com/us/app/dhamma-radio-station/id551148771?mt=8
တိပိဋကpitakataw.comhttp://www.pitakataw.com/
Toolbar TV+Radio+moreDhamma Toolbarhttp://dhammatv.ourtoolbar.com/
Facebook GroupShare Dhamma on Facebookhttp://www.facebook.com/groups/dhammavideo/
Facebook PageFanpagehttp://www.facebook.com/dhammavideopage
TwitterFollow Us on Twitterhttps://twitter.com/dhammavideo/
Livehttp://www.myanmartube.com/channels
Follow Us on Twitterhttps://twitter.com/dhammavideo

Backlinks Scheme

Backlinks Graphic

Safety
Avg AntivirusSafe
Wot RaitingN/A
SiteAdvisorNot yet rated
Child SafetyNot yet rated

Search Volume Index
Time Elapsed: 0.15667 sec
aaa