Home                                                                                                                                                           
 

checkfilename.com

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search


Ip-
Status-
CountryCode-
CountryName-
RegionCode-
RegionName-
City-
ZipPostalCode-
Latitude-
Longitude-
 
checkfilename.com
checkfilename.com 9.23 out of 10 based on 66 ratings.
Info checkfilename.com
Alexa Rank: 1,519,334
Title: Library to check authenticity of files & registries
Description: CheckFileName is a library to check authenticity of any file, be it exe, dll or any other file. Simply search on file name, md5, product name or company name to get complete information on it
Visits per day: 644
Daily Ads Revenue: $3.2
Creation Date: 2008-06-09
Domain Age: 9years 191days
Ip: 169.55.71.151
Last update:
24-05-2017 04:19:34 (6 months ago)
 

ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare checkfilename.com to:

www.checkfilename.com

Worldwide Traffic Rank
 

Country Users Rank

Websites Hosted On Same Network Analysis
No sites were found to be hosted in the same network with checkfilename.com

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
1,519,312nowywyszkowiak.pl79.96.32.187     Poland
1,519,323myanmar2day.com192.185.170.204n/a
1,519,325pridesystems.co.in74.52.113.226n/a
1,519,328cinegola.com115.112.186.239     India
1,519,330reallifeconnect.com109.239.59.248n/a
1,519,334checkfilename.com169.55.71.151n/a -
1,519,335unionbanknc.com74.200.56.239n/a
1,519,338treasurybrisbane.com.au203.52.90.187     Australia
1,519,339bionet.jp180.222.90.15n/a
1,519,340multimediaspeakersystemreviews.com50.22.98.221n/a
1,519,342fusemetrix.com213.219.53.32     United Kingdom

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:checkfilename.com
Yahoo Indexed Links: Go to http://siteexplorer.search.yahoo.com and type checkfilename.com
Google backlinks: Go to www.google.com and type link:checkfilename.com
Yahoo backlinks: Go to http://siteexplorer.search.yahoo.com and type checkfilename.com
Dmoz: No
Tags: CheckFileName find genuine file file report investigate file file info
Domain Archive: Go to http://whois.domaintools.com and type your site.

IP & Spy Tools
Country:
Nameservers: NS-1008.AWSDNS-62.NET : 205.251.195.240
NS-1379.AWSDNS-44.ORG : 205.251.197.99
NS-146.AWSDNS-18.COM : 205.251.192.146
NS-1615.AWSDNS-09.CO.UK : 205.251.198.79
Adsense ID: not found
Analytics ID: UA-2849924
Same Adsense Account: not found
Same Analytics Account: photostudio.systweak.com fix-all-dll-errors.com systweak.com help.winzip.com powerbundle.systweak.com
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.
Time Elapsed: 0.20557 sec