Home                                                                                                                                                           
Advertisement

base-flying.de

 DOMAIN REPORT  
  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search

A description has not been provided for this site.

Ip62.146.97.22
Statusok
CountryCodeDE
CountryNameGermany
RegionCode02
RegionNameBayern
CityMainburg
ZipPostalCode-
Latitude48.65
Longitude11.7833
Alexa traffic rank for base-flying.de:
Time RangeTraffic RankChange 
3 Months3,973,472% 
Percent of global Internet users who visit base-flying.de:
Time RangeReachChange 
3 Months0.000021% 
Percent of global pageviews on base-flying.de:
Time RangePageviewsChange 
3 Months0.00000035% 
Daily pageviews per user for base-flying.de:
Time RangePageviews/UserChange 
3 Months1.5% 
The percentage of visits to base-flying.de that consist of a single pageview:
Time RangeBounce %Change 
3 Months60.7% 
Daily time on site for base-flying.de:
Time RangeTime on Site(minutes)Change 
The percentage of visits to base-flying.de that came from a search engine:
Time RangeSearch %Change 
3 Months7.1% 
Advertisement
base-flying.de
base-flying.de 8.01 out of 10 based on 13 ratings.
Info base-flying.de
Alexa Rank: 13,311,137
Title: Base Flying in Berlin | base-flying.de
Description: Base Flying in Berlin am Alexanderplatz: Aus 125 Metern angeseilt vom Dach fliegen mit der schnellsten Personenabseilwinde der Welt. Tickets ab € 49,90. Wann fliegst Du?
Visits per day: 86
Daily Ads Revenue: $0.93
Website Worth: $ 419
Creation Date: No info
Domain Age: N/A
Domain Expires:
Server Location: Bayern, Germany
Domain Registrar: DENIC eG
Ip: 185.157.21.65
Last update:
16-04-2019 11:16:28 (4 months ago)
Advertisement

WEBSITES LIKE base-flying.de

Sites Like base-flying.de ( 31 ):

berlin ohio, amish country

berlinohio.com

berlin ohio, the heart of ohios amish country.
sun travel biuro podr\0y, pia, pikna polska, turystyka aktywna, grupy, wycieczki krajowe, wycieczki zagraniczne, kajaki, spywy kajakowe, wypoyczalnia kajakw, incentive

pieknapolska.com

wycieczki szkolne, wakacje, kajak, wypoczynek, pikna polska,praga, krpsko, spyw draw, tropikalna wyspa, wypoyczalnia kajakw, wiede, spywy kajakowe, polietylenowej, incentive, kajak bri
the berlin fan page

berlinpage.com

berlin web site. history, images, tour dates, sound clips, and everything related to berlin / terri nunn / etc. with information on new ep, music bands reunited vh1 vh-1 john crawford david diamond
berlin cameron united

bc-p.com

berlin cameron united is a leading creative advertising agency in the us, offering ad development services for television, print, and interactive media, as well as services for campaign planning and m
:::::::::::blanca berlin galeria fotografica::::::::::::::

blancaberlingaleria.com

blanca berln0020galera0020ya se ha convertido en un punto de encuentro del arte fotogrf0069co madrileo00200079 en un referente en el panorama arts0074ico nacional e internacional. especializada en fotografa0020y art
berlin // voy a berlin - guia de berlin

voyaberlin.com

gua0020de berln0020con informacin00200073obre la ciudad de berlin. monumentos de berlin, historia, turismo, albergues, transporte pb006c00690063o en berlin y consejos prc0074icos para visitar berlin.
immobilie-suchen.com - aktuelle immobilienangebote in europa

immobiliesuchen.com

die neuesten eintr䧥 der immobilienb\0 bei www.immobilie-suchen.com - immobiliendatenbank f\0tschland und europa mit immobilien in deutschland \0rreich schweiz italien griechenland spanien sc
apartamentos berl㭮 - alojamiento en el mar menor

apberlin.com

apartamentos berlin. estudios en una zona tranquila de lo pag㡮 (san pedro del pinatar - murcia). trato directo y atenci㳮 al cliente. disfrute de sus vacaciones al mejor precio.
berlin - j껹k angielski, niemiecki... kursy! szkoa j껹k\0bcych

berlin.edu.pl

,berlin - j껹k niemiecki angielski i inne - szkoa j껹k\0bcych sjo
h.g. hagelgans heizungs-, feuerungsbau und sanit䳴echnik gmbh

hagelgans-gmbh.de

heizung-,feuerungsbau-,& sanit䳴echnik gmbh
astrologie, horoskope, berlin - birgit von borstel

birgitvonborstel.de

psychologische astrologie, horoskope, berlin - birgit von borstel
gesang inez otto

inez-otto.de

homepage von inez otto.
sv s㽤en 09 e.v.: startseite

sueden-09.de

dies ist die offizielle homepage des sv s㽤en 09 e.v. - der fu㿢allverein in berlin-mariendorf
home – mews steuerberatung – berlin ⻠mews steuerberatung - berlin

mews-steuerberatung.de

steuerkummer? – servicenummer tel.: 030-851 20 37
Helliwood media & education

helliwood.de

"Nil tam difficile est, quod non sollertia vincat!"
weihnachtsmarkt auf dem winterfeldtplatz in berlin

weihnachtsmarkt-winterfeldtplatz.de

der traditionelle weihnachtsmarkt auf dem winterfeldtplatz ist einzigartig und an den adventssonntagen geet.
Zahar.de -

zahar.de

desc
schweiger design | herzlich willkommen

schweiger-design.de

wir sind eine grafik und design agentur in der brandenburgischen landeshauptstadt potsdam nahe berlin
art-repro der fotograf christoph petras aus berlin

art-repro.de

willkommen bei art-repro.de, der fotografischen dienst fstler
berlin tours – walking tour, bike tour, bus tour, berlin wall tour - sightseeing in berlin

sightseeing-point-berlin.com

sightseeing in berlin: tour guides, berlin tours, walking tours, bike tours, bus tours, berlin wall tour and more
die diplomandin

blog.diediplomandin.de

ein blog f㽲 alle ㅲzte, architekten, anw㥬te und zahn㥲zte
das buch am hackeschen markt berlin

leseland-berlin.de

herzlich willkommen in der buchhandlung das buch am hackeschen markt neue promenade 6 in berlin-mitte. auf unserer homepage können sie in umfangreichen datenbanken (buchkatalog des großh&au
Claudia Hämmerling

claudia-haemmerling.de

Seite von Claudia Hämmerling - Mitglied des Abgeordnetenhauses für Bündnis 90/Die Grünen. Themen: Kritik der Stadtplanungspolitik des Berliner Senats, Großflächiger Einzelhandel, Verbraucherschutz, Umweltschutz in Berlin, Ra
Base Flying in Berlin | base-flying.de

base-flying.de

Base Flying in Berlin am Alexanderplatz: Aus 125 Metern angeseilt vom Dach fliegen mit der schnellsten Personenabseilwinde der Welt. Tickets ab € 49,90. Wann fliegst Du?
bvg.de - startseite

bvg.de

svenska skolan i berlin | "skolan som bevarar och v㥲nar om det nordiska och integrerar det tyska."

svenskaskolan-berlin.de

town of berlin home page

townofberlin.com

berlin night express

berlin-night-express.com

berliner eissport-verband e.v.

eissport-berlin.de

b b g e s

bbges.de


ALEXA TRAFFIC & RANK BY COUNTRY
Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare base-flying.de to:
 

www.base-flying.de

Worldwide Traffic Rank
Country Rank
    
Germany:
320,743

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
n/a spontacts.com ≈9,062$28.66134,583185.157.21.54
n/a presse.jochen-schweizer.de ≈20,892$64.0354,500185.157.21.65
n/a rdeco.gr ≈904$4.031,004,364185.157.210.10
n/a hellasbusinessbook.gr ≈1,214$4.96935,088185.157.210.10
n/a all4mama.gr ≈1,271$5.16877,778185.157.210.11

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
13,311,074proximacentauri.it62.149.128.151n/a
13,311,086mailleferextrusion.com91.212.211.109n/a
13,311,092kingsonmold.com206.82.205.101n/a
13,311,111cn48.net218.6.12.241n/a
13,311,117interlakenhotels.biz204.197.242.64n/a
13,311,137base-flying.de185.157.21.65n/a -
13,311,140stjamesandemmanuel.org95.154.214.131n/a
13,311,142mytierraverde.com173.236.98.98n/a
13,311,143lulus-bbq.com98.129.157.35n/a
13,311,151jakobjenzer.ch82.195.225.101n/a
13,311,157web-hostess.com96.9.186.53n/a

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:base-flying.de
Yahoo Indexed Links: show yahoo links
Google backlinks: show google backlinks
Yahoo backlinks: show yahoo backlinks
Dmoz: No
Tags: Base Flying Base Flying Berlin Berlin Alexanderplatz Park Inn Base Flyer
Domain Archive: Click here to view details

IP & Spy Tools
Nameservers: NS0.CLUSTER-TEAM.NET : 62.116.159.139
NS1.CLUSTER-TEAM.NET : 217.160.113.176
NS2.CLUSTER-TEAM.NET : 89.146.248.135
NS3.CLUSTER-TEAM.NET : 74.208.254.135
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.

DNS Records
HostTypeTarget / IPClassTTLOther
www.base-flying.deA62.146.97.75IN5 
www.base-flying.de has address 62.146.97.75


Backlinks Graphic

Safety
Avg AntivirusSafe
Wot RaitingN/A
SiteAdvisorNot yet rated
Child SafetyNot yet rated

Search Volume Index
Time Elapsed: 0.36168 sec
aaa